PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold05850-augustus-gene-0.17-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 335aa    MW: 37457.9 Da    PI: 6.6267
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold05850-augustus-gene-0.17-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                                Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                                   +g+WT+eEd++l d++k +G g+W++ ++  g++R++k+c++rw +yl
  maker-scaffold05850-augustus-gene-0.17-mRNA-1 14 KGPWTPEEDQKLTDYIKSHGHGSWRSLPKQAGLNRCGKSCRLRWTNYL 61
                                                   79********************************************97 PP

2Myb_DNA-binding52.79.5e-1767112148
                                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                                Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                                    rgr++++E+ +++ ++  lG++ W++Ia  ++ gRt++++k++w+++l
  maker-scaffold05850-augustus-gene-0.17-mRNA-1  67 RGRFSEDEERKIISLHSVLGNK-WSRIATQLP-GRTDNEIKNYWNTHL 112
                                                    89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.133961IPR017930Myb domain
SuperFamilySSF466898.99E-3111108IPR009057Homeodomain-like
SMARTSM007176.3E-151363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001671.56E-111661No hitNo description
PROSITE profilePS5129427.52762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2665116IPR009057Homeodomain-like
SMARTSM007179.1E-1666114IPR001005SANT/Myb domain
PfamPF002493.5E-1567112IPR001005SANT/Myb domain
CDDcd001671.24E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLTDYIK SHGHGSWRSL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGRF SEDEERKIIS LHSVLGNKWS RIATQLPGRT DNEIKNYWNT HLRKKLLQMG  120
IDPTTHKPRT DLNHLMNLSQ LLGAASFGNL LSPWNSALAL QADASQLAKI QLLQNMLQVI  180
NTSTLLNLDN VGLLQNQNLN PFEGLVNGTS TLFHKEPLLI GQEYQNQGVV PQAPSNSQGI  240
FNSSSGFEGQ LNMEDFLGSN NSTSSLSSSA CENQTENPMP ALVSGSPGTY TVNQVESKTD  300
PNQFLTQSST STTFEVWEKL KDDETSDFYW KDLLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040638.11e-146Myb domain protein 39, putative
TrEMBLA0A061GDM61e-146A0A061GDM6_THECC; Myb domain protein 39, putative
STRINGVIT_02s0012g01650.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.29e-92myb domain protein 9